PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 344aa    MW: 38864.3 Da    PI: 7.6633
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00557genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw +yl
       AA40G00557 14 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.83.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
       AA40G00557  67 RGKFNLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-26563IPR009057Homeodomain-like
PROSITE profilePS5129426.241965IPR017930Myb domain
SuperFamilySSF466899.54E-3110108IPR009057Homeodomain-like
SMARTSM007177.2E-161363IPR001005SANT/Myb domain
PfamPF002496.2E-171461IPR001005SANT/Myb domain
CDDcd001671.55E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2564117IPR009057Homeodomain-like
PROSITE profilePS5129420.45566116IPR017930Myb domain
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002492.7E-1567112IPR001005SANT/Myb domain
CDDcd001671.14E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRSPCCDKM GLKKGPWTPE EDQKLLAYIE EHGHGSWRSL PEKAGLHRCG KSCRLRWTNY  60
LRPDIKRGKF NLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKPKN ETPLSSIGLS KNAATLSHMA QWESARLEAE ARLARESKLL QLQHYHNINK  180
SVSSSNTHGF THKTSSKWAK PNEDQNQHQQ LESPSSTVTN SSTQRETGNK IRGIEAENKE  240
SSEIPAKIEF IGSSSESSHD WINSTIHEFT TTQMNCCSHQ TTEGIEEGFT RGLLLGDRSF  300
SAGKNETAVE SGDGDCNYYE DNKNYLESIF SFVDPLPSDS SPIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197035.10.0myb domain protein 16
SwissprotQ8GWP01e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLQ9LXF10.0Q9LXF1_ARATH; At5g15310
STRINGAT5G15310.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-169myb domain protein 16